PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G16630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 291aa    MW: 31824.9 Da    PI: 8.8134
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G16630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-15117169148
                      TSSS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+eEd +l  + +q+ gg     +W +++++ g++R++k+c++rw++yl
  LPERR12G16630.1 117 RGPWTAEEDARLRSYMEQHAGGgagagNWMAVPSKAGLRRCGKSCRLRWLNYL 169
                      89******************99*****************************97 PP

2Myb_DNA-binding48.22.5e-15176218246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T++Ed l+v +++  G++ W++Ia +++ gRt++++k++w++
  LPERR12G16630.1 176 GGFTADEDRLIVALHAAVGSR-WSLIAGHLP-GRTDNHVKNYWNT 218
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.975112169IPR017930Myb domain
SuperFamilySSF466892.94E-26115216IPR009057Homeodomain-like
SMARTSM007171.0E-8116171IPR001005SANT/Myb domain
PfamPF002496.1E-13117169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21118176IPR009057Homeodomain-like
CDDcd001671.58E-5119169No hitNo description
PROSITE profilePS5129423.054170224IPR017930Myb domain
SMARTSM007176.2E-12174222IPR001005SANT/Myb domain
PfamPF002495.9E-13176218IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-23177223IPR009057Homeodomain-like
CDDcd001676.43E-9178220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MHSAIFGIGT GGGLCGCGSA AVRMRRRLLA LSHDDLGRVD PLASSARAVC RAEEDARQPA  60
VVFTSGMAVT VWTQWGAEGH ADAGGWRRPC ECCVVFDDGT GQRSTRTRWV VLAAVKRGPW  120
TAEEDARLRS YMEQHAGGGA GAGNWMAVPS KAGLRRCGKS CRLRWLNYLR PGIRHGGFTA  180
DEDRLIVALH AAVGSRWSLI AGHLPGRTDN HVKNYWNTRL KKRVEMIFSF SPNAGNYQPS  240
PPSFSRYGGA GDYSSSSAQS ESMDEMMVNW CSQINQLELQ DELLLQNVQP Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-241172257109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7318871e-35AL731887.5 Oryza sativa chromosome 12, . BAC OJ1559_C07 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL8318091e-35AL831809.3 Oryza sativa chromosome 12, . BAC OJ1268_D02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149681e-35AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankCP0126201e-35CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9Y1R70.0A0A0D9Y1R7_9ORYZ; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23000.14e-50myb domain protein 37